RecombinantIL-8/CXCL8 (8-79aa), Human (CHO-expressed)
Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.
Product Specifications
Product Name Alternative
Interleukin-8, IL8, XCL8, monocyte-derived neutrophil chemotactic factor (MDNCF), neutrophil activating factor (NAF), NAP-1
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
~9 kDa, observed by reducing SDS-PAGE
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral human AAAS shRNA (UAS) - Lentiviral human AAAS shRNA (UAS, iRFP) plasmid
Vmn1r155 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Phospho-Aurora B (Thr232) + Aurora C (Thr198) Polyclonal Antibody, APC Conjugated
