Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-9, Human

Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

Product Name Alternative

Interleukin-9, IL9

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal OXSM Antibody (OTI4E10) [Alexa Fluor 350]
NBP2-73176AF350 0.1 mL

Mouse Monoclonal OXSM Antibody (OTI4E10) [Alexa Fluor 350]

Sign In for Pricing
View Details
Magic™ Human EGFR (L858R, T790M, L718V) BaF3 Cell Line
S01YF-1222-KX598 1 Vial

Magic™ Human EGFR (L858R, T790M, L718V) BaF3 Cell Line

Sign In for Pricing
View Details
Goat FK506 Binding Protein 1A ELISA Kit
MBS084298 Inquire

Goat FK506 Binding Protein 1A ELISA Kit

Sign In for Pricing
View Details
Anti-PBRM1 Antibody Picoband® Fluoro647 Conjugated
A01130-1-Fluoro647 100 µg/Vial

Anti-PBRM1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
APP Biosimilar Antibody
orb3182254-01 100 µg

APP Biosimilar Antibody

Sign In for Pricing
View Details
APP Biosimilar Antibody
orb3182254-02 500 µg

APP Biosimilar Antibody

Sign In for Pricing
View Details