Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-9, Human

Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

Product Name Alternative

Interleukin-9, IL9

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXND1 Antibody, HRP conjugated
A56352-100UG 100 µg

PLXND1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Mouse SREBF1 Protein, His (Fc)-Avi-tagged
SREBF1-8709M 50 µg

Recombinant Mouse SREBF1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Cd80 Rat Monoclonal Antibody [Clone ID: RMMP-1]
AM31878PU-N 200 µg

Cd80 Rat Monoclonal Antibody [Clone ID: RMMP-1]

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)
MBS2092541-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)
MBS2092541-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)
MBS2092541-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Haptoglobin (Hpt)

Sign In for Pricing
View Details