Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantLIX/CXCL5 (88aa), Rat

LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5 (CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78) . It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Rat LIX cDNA encodes a 130 aa residue precursor with a predicted 37 aa residue signal peptide and a 93 aa residue mature protein. Among human CXC chemokines, rat LIX is most closely related to human GCP-2 and ENA-78.LIX can signal through the CXCR2 receptor.Recombinant rat LIX/CXCL5 (88aa) produced in CHO cells is a polypeptide chain containing 88 amino acids. A fully biologically active molecule, rrLIX/CXCL5 (88aa) has a molecular mass of 9.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 5, Small-inducible cytokine B5, Cytokine LIX, Cxcl5, Scyb5, LIX, GCP-2, Scyb6, ENA-78, AMCF-II.

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat LIX/CXCL5 (88aa) on Caˆ2+ mobilization assay in CHO-K1/G15/rCXCR2 cells (human Ga15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 3 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9.6 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat LIX/CXCL5 (88aa) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat LIX/CXCL5 (88aa) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK ILGSENKKTKRNALALVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued
047332-01 10 µg

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued
047332-02 50 µg

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
LCN10 Human Pre-designed siRNA Set A
HY-RS07555 1 Set

LCN10 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
TRPC7 siRNA (Human)
CRJ1330-01 15 nmol

TRPC7 siRNA (Human)

Sign In for Pricing
View Details
TRPC7 siRNA (Human)
CRJ1330-02 30 nmol

TRPC7 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-4 Antibody [Alexa Fluor 594]
NBP2-97308AF594 0.1 mL

Rabbit Polyclonal Caspase-4 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details