RecombinantLIX/CXCL5 (88aa), Rat
LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5 (CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78) . It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Rat LIX cDNA encodes a 130 aa residue precursor with a predicted 37 aa residue signal peptide and a 93 aa residue mature protein. Among human CXC chemokines, rat LIX is most closely related to human GCP-2 and ENA-78.LIX can signal through the CXCR2 receptor.Recombinant rat LIX/CXCL5 (88aa) produced in CHO cells is a polypeptide chain containing 88 amino acids. A fully biologically active molecule, rrLIX/CXCL5 (88aa) has a molecular mass of 9.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
Product Name Alternative
C-X-C motif chemokine 5, Small-inducible cytokine B5, Cytokine LIX, Cxcl5, Scyb5, LIX, GCP-2, Scyb6, ENA-78, AMCF-II.
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
9.6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK ILGSENKKTKRNALALVR
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
