Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantM-CSF, Human (CHO-expressed)

Human Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers.

Product Specifications

Product Name Alternative

Macrophage Colony Stimulating Factor, CSF-1, Lanimostim, MCSF, M-CSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

32-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Macrophage-Colony Stimulating Factor (rhM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQL QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PITX2 (Paired-like Homeodomain 2, ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS) (MaxLight 550)
250140-ML550 100 µL

PITX2 (Paired-like Homeodomain 2, ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS) (MaxLight 550)

Sign In for Pricing
View Details
Dirithromycin discontinued. See 257258
010847-01 10 mg

Dirithromycin discontinued. See 257258

Sign In for Pricing
View Details
Dirithromycin discontinued. See 257258
010847-02 1 g

Dirithromycin discontinued. See 257258

Sign In for Pricing
View Details
Dirithromycin discontinued. See 257258
010847-03 10 g

Dirithromycin discontinued. See 257258

Sign In for Pricing
View Details
Mouse Lysosome-associated membrane glycoprotein 3, LAMP3 ELISA Kit
MBS9319367-01 48 Well

Mouse Lysosome-associated membrane glycoprotein 3, LAMP3 ELISA Kit

Sign In for Pricing
View Details
Mouse Lysosome-associated membrane glycoprotein 3, LAMP3 ELISA Kit
MBS9319367-02 96 Well

Mouse Lysosome-associated membrane glycoprotein 3, LAMP3 ELISA Kit

Sign In for Pricing
View Details