Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMIP-1β/CCL4, Human

Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1β is a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1β has been shown to interact with CCL3. It can signal through the CCR5 receptor.Recombinant MIP-1 beta/CCL4 produced in CHO is a polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 10-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

MIP1β, Macrophage Inflammatory Protein-1β, CCL4, ACT-2

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

The EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

10-19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human MIP-1β/CCL4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1β/CCL4 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr281 (NM_001000225) Rat Tagged ORF Clone
RR204708 10 µg

Olr281 (NM_001000225) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Rat UPF0458 protein C7orf42 homolog
MBS7039530-01 0.02 mg

Recombinant Rat UPF0458 protein C7orf42 homolog

Sign In for Pricing
View Details
Recombinant Rat UPF0458 protein C7orf42 homolog
MBS7039530-02 0.1 mg

Recombinant Rat UPF0458 protein C7orf42 homolog

Sign In for Pricing
View Details
Recombinant Rat UPF0458 protein C7orf42 homolog
MBS7039530-03 5x 0.1 mg

Recombinant Rat UPF0458 protein C7orf42 homolog

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens Ribonuclease H (rnhA)
MBS1394987-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens Ribonuclease H (rnhA)
MBS1394987-02 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens Ribonuclease H (rnhA)

Sign In for Pricing
View Details