RecombinantMIP-1β/CCL4, Human
Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1β is a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1β has been shown to interact with CCL3. It can signal through the CCR5 receptor.Recombinant MIP-1 beta/CCL4 produced in CHO is a polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 10-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
Product Name Alternative
MIP1β, Macrophage Inflammatory Protein-1β, CCL4, ACT-2
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
10-19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
SULT2A1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
SULT2A1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
Recombinant Schizosaccharomyces pombe Uncharacterized protein new13 (new13)
Recombinant Schizosaccharomyces pombe Uncharacterized protein new13 (new13)