Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMIP-3α/CCL20, Human (CHO-expressed)

Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.Recombinant humanMIP-3 alpha/CCL20 produced in CHO cells is a polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3 alpha/CCL20 has a molecular mass of 8kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

MIP3α, MIP-3 alpha, CCL20

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clemastine Fumarate
TRC-C568500-25MG 25 mg

Clemastine Fumarate

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]
E-AB-F1082J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501179 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Sodium
TRC-C661140-25MG 25 mg

(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Sodium

Sign In for Pricing
View Details