Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMPIF-1/CCL23, Human

Myeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow and placenta. It is also expressed in some cell lines of myeloid origin. It is highly chemotactic for resting T cells and monocytes and slightly chemotactic for neutrophils. MPIF-1 has been shown to inhibit colony formation of bone marrow myeloid immature progenitors. It has also been attributed to an inhibitory activity on hematopoietic progenitor cells. MPIF-1 is a ligand for the chemokine receptor CCR1.Recombinant human MPIF-1/CCL23 produced in CHO cells is a single polypeptide chain containing 99 amino acids. A fully biologically active molecule, rhMPIF-1/CCL23 has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

MPIF-1, CCL23

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human MPIF-1/CCL23 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 2 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

12 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant humanMPIF-1°CCL23 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human MPIF-1°CCL23 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nars sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31462116 3x 1.0 µg

Nars sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
H3F3C sgRNA CRISPR Lentivector (Human) (Target 3)
K2773904 1.0 µg DNA

H3F3C sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IgG F (ab') 2 Antibody
OARA05391-10MG 10 mg

IgG F (ab') 2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Apolipoprotein A5 Antibody (4H8H8E2) [DyLight 350]
NB110-57307UV 0.1 mL

Mouse Monoclonal Apolipoprotein A5 Antibody (4H8H8E2) [DyLight 350]

Sign In for Pricing
View Details
MDL-800, SIRT6 allosteric activator
TBI4415-10MG 10 mg

MDL-800, SIRT6 allosteric activator

Sign In for Pricing
View Details
RN5S488 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV745709 1.0 µg DNA

RN5S488 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details