Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNeuroserpin, Human

Neuroserpin is an inhibitory serpin that is expressed predominantly in central nervous system. Although the physiological target of neuroserpin is still unclear, cumulative evidence suggest that it plays an important role in controlling proteolytic degradation of extracellular matrix (ECM) during synaptogenesis and the subsequent development of neuronal plasticity. In the adult brain, neuroserpin is secreted from the growth cones of neurons in areas where synaptic changes are associated with learning and memory, i.e. cerebral cortex, hippocampus, and amygdala. The neuroprotective role of neuroserpin has been demonstrated in transgenic mice lacking neuroserpin expression. The deficiency of neuroserpin in these mice was associated with motor neuron disease characterized by axonal degradation. In humans, defects in neuroserpin, caused by point mutations in the neuroserpin gene, underlie a hereditary disorder called the familial encephalopathy with neuroserpin inclusion bodies (FENIB) .

Product Specifications

Product Name Alternative

Serpin I1, Protease inhibitor 12

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 500 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

40-45 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Neuroserpin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh_Neuroserpin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNM VTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAAT YLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLV LSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKA IHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpy19l3-set siRNA/shRNA/RNAi Lentivector (Rat)
18575096 4x 500 ng

Dpy19l3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-1 beta/IL-1F2 Antibody (1027B) [Janelia Fluor 635]
FAB8406JF635 0.1 mL

Rabbit Monoclonal IL-1 beta/IL-1F2 Antibody (1027B) [Janelia Fluor 635]

Sign In for Pricing
View Details
Vmn1r51 (NM_011683) Mouse Tagged ORF Clone Lentiviral Particle
MR204289L4V 200 µL

Vmn1r51 (NM_011683) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (HRP)
MBS6153384-01 0.1 mL

Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (HRP)

Sign In for Pricing
View Details
Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (HRP)
MBS6153384-02 5x 0.1 mL

Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (HRP)

Sign In for Pricing
View Details
Peroxiredoxin 5/PRDX5 Rabbit Polyclonal Antibody (Cy3)
orb2576781 100 µg

Peroxiredoxin 5/PRDX5 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details