Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNeuroserpin, Human

Neuroserpin is an inhibitory serpin that is expressed predominantly in central nervous system. Although the physiological target of neuroserpin is still unclear, cumulative evidence suggest that it plays an important role in controlling proteolytic degradation of extracellular matrix (ECM) during synaptogenesis and the subsequent development of neuronal plasticity. In the adult brain, neuroserpin is secreted from the growth cones of neurons in areas where synaptic changes are associated with learning and memory, i.e. cerebral cortex, hippocampus, and amygdala. The neuroprotective role of neuroserpin has been demonstrated in transgenic mice lacking neuroserpin expression. The deficiency of neuroserpin in these mice was associated with motor neuron disease characterized by axonal degradation. In humans, defects in neuroserpin, caused by point mutations in the neuroserpin gene, underlie a hereditary disorder called the familial encephalopathy with neuroserpin inclusion bodies (FENIB) .

Product Specifications

Product Name Alternative

Serpin I1, Protease inhibitor 12

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 500 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

40-45 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Neuroserpin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh_Neuroserpin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNM VTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAAT YLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLV LSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKA IHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGAL (LCN2) Mouse Monoclonal Antibody [Clone ID: OTI6F1]
TA814373 100 µL

NGAL (LCN2) Mouse Monoclonal Antibody [Clone ID: OTI6F1]

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)
MBS7110994-01 0.02 mg (Yeast)

Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)
MBS7110994-02 0.1 mg (Yeast)

Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)
MBS7110994-03 1 mg (Yeast)

Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)
MBS7110994-04 5x 1 mg (Yeast)

Recombinant Mouse Guanine nucleotide-binding protein G (o) subunit alpha (Gnao1)

Sign In for Pricing
View Details
ZNF770 Rabbit Polyclonal Antibody (Biotin)
orb450389 100 µL

ZNF770 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details