Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNOV, Human

Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.

Product Specifications

Product Name Alternative

Nephroblastoma Overexpressed gene, CCN3, IGFBP9, NovH

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20-50 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK TTRGKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD5 Antibody Picoband® (monoclonal, 4E2), Dylight550 Conjugate
M00480-2-Dylight550 100 µg

Anti-CD5 Antibody Picoband® (monoclonal, 4E2), Dylight550 Conjugate

Sign In for Pricing
View Details
Human PBK siRNA
abx927824-01 15 nmol

Human PBK siRNA

Sign In for Pricing
View Details
Human PBK siRNA
abx927824-02 30 nmol

Human PBK siRNA

Sign In for Pricing
View Details
Methyl 2-amino-5-{[ (tert-butoxy) carbonyl] (methyl) amino}benzoate
AVD26073-01 50 mg

Methyl 2-amino-5-{[ (tert-butoxy) carbonyl] (methyl) amino}benzoate

Sign In for Pricing
View Details
Methyl 2-amino-5-{[ (tert-butoxy) carbonyl] (methyl) amino}benzoate
AVD26073-02 0.5 g

Methyl 2-amino-5-{[ (tert-butoxy) carbonyl] (methyl) amino}benzoate

Sign In for Pricing
View Details
SDC3 antibody
70R-20126 50 μL

SDC3 antibody

Sign In for Pricing
View Details