Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-DD, Human

PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.

Product Specifications

Product Name Alternative

Platelet-derived growth factor D, IEGF, SCDGFB

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

19-21 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-SLC39A5 Plasmid
PVT16260 2 µg

pCMV-SPORT6-SLC39A5 Plasmid

Sign In for Pricing
View Details
CD28 (C28/74), CF647 conjugate, 0.1mg/mL
BNC470074-100 1x 100 µL

CD28 (C28/74), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPEF2 Protein Vector (Mouse) (pPM-C-HA)
45269024 500 ng

SPEF2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human SV2B Pre-designed siRNA Set B
SI016078B 1 Each

Human SV2B Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human Claudin-6 Protein, His-SUMO, Invitro-E.coli-50ug
QP9973-iv-50ug 50ug

Recombinant Human Claudin-6 Protein, His-SUMO, Invitro-E.coli-50ug

Sign In for Pricing
View Details
ADCY6 Rabbit Polyclonal Antibody
orb624510-01 50 µg

ADCY6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details