Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-DD, Human

PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.

Product Specifications

Product Name Alternative

Platelet-derived growth factor D, IEGF, SCDGFB

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

19-21 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ift81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3218508 1.0 µg DNA

Ift81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Herpud2 (NM_020586) Mouse Tagged ORF Clone
MG206353 10 µg

Herpud2 (NM_020586) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ARHGAP28 Human Over-expression Lysate
orb1362968 20 µg

ARHGAP28 Human Over-expression Lysate

Sign In for Pricing
View Details
ABCB9 Antibody
MBS8590072-01 0.1 mg

ABCB9 Antibody

Sign In for Pricing
View Details
ABCB9 Antibody
MBS8590072-02 0.1 mL (AF405L)

ABCB9 Antibody

Sign In for Pricing
View Details
ABCB9 Antibody
MBS8590072-03 0.1 mL (AF405S)

ABCB9 Antibody

Sign In for Pricing
View Details