Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSDF-1β/CXCL12, Mouse

SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 β/CXCL12 produced in CHO cells is a polypeptide chain containing 78 amino acids. A fully biologically active molecule, rm SDF-1β/CXCL12 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

SDF-1 β, Stromal-Cell Derived Factor-1, CXCL12, PBSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse SDF-1/CXCL12 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8.5 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse SDF-1 β/CXCL12 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse SDF-1β/CXCL12 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNKRLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoorientin
TRC-I821820-1MG 1 mg

Isoorientin

Sign In for Pricing
View Details
Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG22F-MAL 10x 96 Well Plates

Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
FGF13 (NM_004114) Human Over-expression Lysate
LY418207 100 µg

FGF13 (NM_004114) Human Over-expression Lysate

Sign In for Pricing
View Details
11-Bromo-1-undecene
TRC-B688895-500MG 500 mg

11-Bromo-1-undecene

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL
BNC942561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF568 conjugate, 0.1mg/mL
BNC681194-500 1x 500 µL

EGFR (31G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details