Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSDF-1β/CXCL12, Mouse

SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 β/CXCL12 produced in CHO cells is a polypeptide chain containing 78 amino acids. A fully biologically active molecule, rm SDF-1β/CXCL12 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

SDF-1 β, Stromal-Cell Derived Factor-1, CXCL12, PBSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse SDF-1/CXCL12 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8.5 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse SDF-1 β/CXCL12 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse SDF-1β/CXCL12 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNKRLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Porcine PP (Pepsin) ELISA Kit
E-UNEL-P0018-01 5x 96 Tests

Uncoated Porcine PP (Pepsin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine PP (Pepsin) ELISA Kit
E-UNEL-P0018-02 15x 96 Tests

Uncoated Porcine PP (Pepsin) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS705693 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
(R,S)-1-Tosyl Glycerol-d5
TRC-T664002-5MG 5 mg

(R,S)-1-Tosyl Glycerol-d5

Sign In for Pricing
View Details
SEMA5B (NM_001031702) Human Over-expression Lysate
LC422156 20 µg

SEMA5B (NM_001031702) Human Over-expression Lysate

Sign In for Pricing
View Details
ITPR3 Human Gene Knockout Kit (CRISPR)
KN222737RB 1 Kit

ITPR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details