Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantShh, Mouse (CHO-expressed)

Members of the Hedgehog (Hh) family are highly conserved proteins which are widely represented throughout the animal kingdom. The three known mammalian Hh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh) are structurally related and share a high degree of amino-acid sequence identity (e.g., Shh and Ihh are 93% identical) . The biologically active form of Hh molecules is obtained by autocatalytic cleavage of their precursor proteins and corresponds to approximately the N-terminal one half of the precursor molecule. Although Hh proteins have unique expression patterns and distinct biological roles within their respective regions of secretion, they use the same signaling pathway and can substitute for each other in experimental systems. Recombinant E.coli derived Human Sonic HedgeHog is a 20.0 kDa protein consisting of 176 amino acid residues, including an N-terminal Ile-Val-Ile sequence substituted for the natural occurring chemically modified Cys residue.

Product Specifications

Product Name Alternative

SHH, HHG-1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1 x 10ˆ3 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Sonic Hedgehog (SHH) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmSHH should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHC SVKAENSVAAKSGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin-specific protease 25 (USP25) ELISA Kit
YP-W19883-01 48 Tests

Human Ubiquitin-specific protease 25 (USP25) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-specific protease 25 (USP25) ELISA Kit
YP-W19883-02 96 Tests

Human Ubiquitin-specific protease 25 (USP25) ELISA Kit

Sign In for Pricing
View Details
GCGR Protein Vector (Rat) (pPM-C-His)
PV269817 500 ng

GCGR Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Locusta migratoria Cuticle protein 38
MBS1124108-01 0.02 mg (E-Coli)

Recombinant Locusta migratoria Cuticle protein 38

Sign In for Pricing
View Details
Recombinant Locusta migratoria Cuticle protein 38
MBS1124108-02 0.1 mg (E-Coli)

Recombinant Locusta migratoria Cuticle protein 38

Sign In for Pricing
View Details
Recombinant Locusta migratoria Cuticle protein 38
MBS1124108-03 0.02 mg (Yeast)

Recombinant Locusta migratoria Cuticle protein 38

Sign In for Pricing
View Details