RecombinantThymusChemokine‐1/CXCL7, Rat
Thymus Chemokine‐1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7), is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine‐1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine‐1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine‐1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine‐1 and may account for lack of Thymus Chemokine‐1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.Recombinant rat Thymus Chemokine‐1/ CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine‐1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
Product Name Alternative
Thymus Chemokine-1, TCK-1, TCK1
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 97% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
9.8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog