Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantThymusChemokine‐1/CXCL7, Rat

Thymus Chemokine‐1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7), is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine‐1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine‐1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine‐1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine‐1 and may account for lack of Thymus Chemokine‐1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.Recombinant rat Thymus Chemokine‐1/ CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine‐1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Thymus Chemokine-1, TCK-1, TCK1

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 97% as analyzed by SDS-PAGE and HPLC.

Bioactivity

The EC50 value of rat Thymus Chemokine‐1/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9.8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Thymus Chemokine‐1°CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thymus Chemokine‐1°CXCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details