Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTNFRI, Human

TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.

Product Specifications

Product Name Alternative

Soluble Tumor Necrosis Factor type I, TNFRSF1A, TNFAR, TNF-R55, TNFR60, p55, CD120a

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-α.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

28~35 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Dimethylpiperidin-4-amine dihydrochloride
LIC70856-01 50 mg

1,4-Dimethylpiperidin-4-amine dihydrochloride

Sign In for Pricing
View Details
1,4-Dimethylpiperidin-4-amine dihydrochloride
LIC70856-02 0.5 g

1,4-Dimethylpiperidin-4-amine dihydrochloride

Sign In for Pricing
View Details
IgM, Murine Isotype Control (FITC)
I1905-06E 100 Tests

IgM, Murine Isotype Control (FITC)

Sign In for Pricing
View Details
Rat Kif1a Pre-designed siRNA Set A
SI207228A 1 Each

Rat Kif1a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Catalase (phospho Tyr386) Polyclonal Antibody
orb1415030 100 µL

Catalase (phospho Tyr386) Polyclonal Antibody

Sign In for Pricing
View Details
ADAMDEC1 Antibody
MBS856111-01 0.1 mg

ADAMDEC1 Antibody

Sign In for Pricing
View Details