Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTPO, Mouse

Thrombopoietin (TPO), also known as C-mpl ligand, MGDF and Thpo, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through MLP/C_MPL receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote the apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.

Product Specifications

Product Name Alternative

Thrombopoietin, Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 ng /ml, measured in a proliferation assay using MO7e cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

30-80 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Thrombopoietin (TPO) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Thrombopoietin (TPO) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml..

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTA VPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGL FAGTSLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPTTHGSPPQLHPLFPDPSTTMPNSTAPH PVTMYPHPRNLSQET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAMT Antibody Picoband®, Carrier-free
A02886-2-carrier-free 100 µg/Vial

Anti-GAMT Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
NFKBIA Antibody
orb572281 100 µL

NFKBIA Antibody

Sign In for Pricing
View Details
B4GALT7 Protein Vector (Human) (pPM-N-D-C-His)
PV326045 500 ng

B4GALT7 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)
MBS7027916-01 0.02 mg

Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)
MBS7027916-02 0.1 mg

Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)
MBS7027916-03 5x 0.1 mg

Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)

Sign In for Pricing
View Details