Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTWEAK, Human

TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis.

Product Specifications

Product Name Alternative

TNF-related weak inducer of apoptosis, TNFSF12, DR3LG, Apo3-Ligand

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TWEAK remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-tert-Butyl-2-chloropyridine
OR346413 500 mg

4-tert-Butyl-2-chloropyridine

Sign In for Pricing
View Details
HETE, 12 (L) (12L-Hydroxeicosantetraenoic) (Not for Export EU)
H2034-45 100 µL

HETE, 12 (L) (12L-Hydroxeicosantetraenoic) (Not for Export EU)

Sign In for Pricing
View Details
Human Pallidin (PLDN) ELISA Kit
QY-E04062 96 Tests

Human Pallidin (PLDN) ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse CD45RC-R-PE Conjugate Antibody
MBS4151740-01 0.1 mg

Anti-Mouse CD45RC-R-PE Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD45RC-R-PE Conjugate Antibody
MBS4151740-02 5x 0.1 mg

Anti-Mouse CD45RC-R-PE Conjugate Antibody

Sign In for Pricing
View Details
Anti-BLNK Antibody Picoband® Fluoro550 Conjugated
A03630-2-Fluoro550 100 µg/Vial

Anti-BLNK Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details