Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantWISP-1, Human

WISP-1, also known as Wnt-1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein, is a cysteine-rich heparin-binding Glycoprotein belonging to the CCN protein family. It is expressed in many internal organs, such as the lung, kidney and spleen. WISP-1 binds to BMP-2 and enhances mesenchymal cell proliferation and osteoblastic differentiation. , WISP-1 has also been reported to attenuate p53-mediated apoptosis and inhibit TNF-induced cell death, suggesting it may play a role intumorigenesis.

Product Specifications

Product Name Alternative

WNT1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

44-46 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human WISP-1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human WISP-1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCD YSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQ WVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFC NLSCRNPNDIFADLESYPDFSEIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A6 Antibody
A66619-100UG 100 µg

SLC26A6 Antibody

Sign In for Pricing
View Details
BSJ-4-116
C14505-25mg 25 mg

BSJ-4-116

Sign In for Pricing
View Details
Mouse Mouse IgG Isotype Control [FITC]
NBP1-96789 1 mg

Mouse Mouse IgG Isotype Control [FITC]

Sign In for Pricing
View Details
Ttc38 Rabbit Polyclonal Antibody
TA363489 100 µL

Ttc38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1CC, CT (PPP1CC, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit, Protein phosphatase 1C catalytic subunit) (Biotin) discontinued
040334-Biotin 200 µL

PPP1CC, CT (PPP1CC, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit, Protein phosphatase 1C catalytic subunit) (Biotin) discontinued

Sign In for Pricing
View Details
anti-DDX1
YF-PA23581 50 ul

anti-DDX1

Sign In for Pricing
View Details