What is the catalog number for RecombinantWISP-1, Human?

The catalog number for RecombinantWISP-1, Human is orb1494658.

What sizes are available for RecombinantWISP-1, Human?

RecombinantWISP-1, Human is available in the following size(s): 5 µg, 25 µg.

How many pack sizes does RecombinantWISP-1, Human come in?

RecombinantWISP-1, Human is available in 2 different pack sizes.

Is RecombinantWISP-1, Human in stock?

RecombinantWISP-1, Human is currently made to order / not held in immediate stock. Contact us for lead time.

RecombinantWISP-1, Human

WISP-1, also known as Wnt-1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein, is a cysteine-rich heparin-binding Glycoprotein belonging to the CCN protein family. It is expressed in many internal organs, such as the lung, kidney and spleen. WISP-1 binds to BMP-2 and enhances mesenchymal cell proliferation and osteoblastic differentiation. , WISP-1 has also been reported to attenuate p53-mediated apoptosis and inhibit TNF-induced cell death, suggesting it may play a role intumorigenesis.

Product Specifications

Product Name Alternative

WNT1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

44-46 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human WISP-1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human WISP-1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCD YSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQ WVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFC NLSCRNPNDIFADLESYPDFSEIAN