Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantBetacellulin, Mouse (HEK293-expressed)

Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.

Product Specifications

Product Name Alternative

BTC

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.08ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

19-24 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]
AN00360J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]
AN00360J-02 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]
AN00360J-03 100 Tests

PerCP/Cyanine5.5 Anti-Human CD25 Antibody[CHI621]

Sign In for Pricing
View Details
Plgrkt (NM_026362) Mouse Tagged ORF Clone
MG201006 10 µg

Plgrkt (NM_026362) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)
KN216080BN 1 Kit

P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beta1 Integrin Mouse Monoclonal Antibody [Clone ID: BV7]
AM26285PU-N 100 µg

Beta1 Integrin Mouse Monoclonal Antibody [Clone ID: BV7]

Sign In for Pricing
View Details