Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantBetacellulin, Mouse (HEK293-expressed)

Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.

Product Specifications

Product Name Alternative

BTC

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.08ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

19-24 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF3 (NM_001040619) Human Over-expression Lysate
LY421782 100 µg

ATF3 (NM_001040619) Human Over-expression Lysate

Sign In for Pricing
View Details
Acetylcholinesterase Microplate Assay Kit
RDSM068 100 Assays

Acetylcholinesterase Microplate Assay Kit

Sign In for Pricing
View Details
Human TAF5L activation kit by CRISPRa
GA109006 1 Kit

Human TAF5L activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700035 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
CD40, Mouse (FGK45.5), CF568 conjugate, 0.1mg/mL
BNC682005-100 1x 100 µL

CD40, Mouse (FGK45.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nefl Chicken Polyclonal Antibody
CH22105-100 100 µL

Nefl Chicken Polyclonal Antibody

Sign In for Pricing
View Details