Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFasR, Human

Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.

Product Specifications

Product Name Alternative

Soluble Fas receptor (sFasR), TNFRSF6, CD95, Apo I, Fas Antigen

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17~29 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP10-8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1186107 1.0 µg DNA

KRTAP10-8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
10L MEM Powder salts and L-glut
50-011-PB 1 Each

10L MEM Powder salts and L-glut

Sign In for Pricing
View Details
ABCG1 Lentiviral Activation Particles (h)
sc-401237-LAC 200 µL

ABCG1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
DMRTC1, NT (DMRTC1, Doublesex- and mab-3-related transcription factor C1)
034685 200 µL

DMRTC1, NT (DMRTC1, Doublesex- and mab-3-related transcription factor C1)

Sign In for Pricing
View Details
Rhizopus delemar CotH3 Protein (N-His, Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) )
P507805 100 µg

Rhizopus delemar CotH3 Protein (N-His, Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) )

Sign In for Pricing
View Details
Recombinant DNA Polymerase gamma-1 Antibody
RC-5870-01 50 μL

Recombinant DNA Polymerase gamma-1 Antibody

Sign In for Pricing
View Details