Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Rat (HEK293-expressed)

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Rectum
CS710722 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Cdkn2d (NM_009878) Mouse Tagged ORF Clone
MG201344 10 µg

Cdkn2d (NM_009878) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Pancreatic Polypeptide (PPY) activation kit by CRISPRa
GA103738 1 Kit

Human Pancreatic Polypeptide (PPY) activation kit by CRISPRa

Sign In for Pricing
View Details
Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI5E12]
CF808270 100 µg

Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI5E12]

Sign In for Pricing
View Details
DL-2-Aminocaprylic Acid
TRC-A603185-1G 1 g

DL-2-Aminocaprylic Acid

Sign In for Pricing
View Details
GAT-1 Antibody
R30811 100 µg

GAT-1 Antibody

Sign In for Pricing
View Details