Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Rat (HEK293-expressed)

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gaboxadol Hydrochloride
TRC-G122900-2.5MG 2.5 mg

Gaboxadol Hydrochloride

Sign In for Pricing
View Details
Allophycocyanin (APC), cross-linked lyophilized solid, ammonium sulfate free
#29092-1000mg 10x 100 mg

Allophycocyanin (APC), cross-linked lyophilized solid, ammonium sulfate free

Sign In for Pricing
View Details
GSTM1 Mouse Monoclonal Antibody [Clone ID: 1H4A4]
AM06705SU-N 100 µL

GSTM1 Mouse Monoclonal Antibody [Clone ID: 1H4A4]

Sign In for Pricing
View Details
Myl12b (NM_023402) Mouse Tagged ORF Clone
MG201457 10 µg

Myl12b (NM_023402) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Htt Mouse Gene Knockout Kit (CRISPR)
KN308042LP 1 Kit

Htt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti Human CEACAM5 Polyclonal
Y054537 100 µL

Anti Human CEACAM5 Polyclonal

Sign In for Pricing
View Details