Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Rat (HEK293-expressed)

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD9 Mouse Monoclonal Antibody [Clone ID: OTI5H2]
CF810188 100 µg

PSMD9 Mouse Monoclonal Antibody [Clone ID: OTI5H2]

Sign In for Pricing
View Details
ECI2 Antibody
KC-565-01 50 μL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-565-02 100 µL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-565-03 1 mL

ECI2 Antibody

Sign In for Pricing
View Details
Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]
AM50115PU-S 100 µg

Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]

Sign In for Pricing
View Details
Recombinant Collagen XVII alpha 1 Antibody
RC-15296-01 50 μL

Recombinant Collagen XVII alpha 1 Antibody

Sign In for Pricing
View Details