Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantG-CSF, Rat (HEK293-expressed)

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25~28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRX, ID (ALL-1, Trithorax-like Protein, Histone-lysine N-methyltransferase MLL, Zinc Finger Protein HRX, Lysine N-methyltransferase 2A, KMT2A, CXXC-type Zinc Finger Protein 7, MLL, CXXC7, HTRX, MLL1, TRX1) (PE) discontinued
M4127-01B-PE 200 µL

HRX, ID (ALL-1, Trithorax-like Protein, Histone-lysine N-methyltransferase MLL, Zinc Finger Protein HRX, Lysine N-methyltransferase 2A, KMT2A, CXXC-type Zinc Finger Protein 7, MLL, CXXC7, HTRX, MLL1, TRX1) (PE) discontinued

Sign In for Pricing
View Details
H2AC21 (NM_175065) Human Untagged Clone
SC306990 10 µg

H2AC21 (NM_175065) Human Untagged Clone

Sign In for Pricing
View Details
[Gln11] -ß- Amyloid (1 - 28) [Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys]
SP-87934-1 1 mg

[Gln11] -ß- Amyloid (1 - 28) [Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys]

Sign In for Pricing
View Details
Mouse Monoclonal CD3 Antibody (G4.18) [Janelia Fluor 549]
NBP1-43458JF549 0.1 mL

Mouse Monoclonal CD3 Antibody (G4.18) [Janelia Fluor 549]

Sign In for Pricing
View Details
IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (MaxLight 550)
MBS6422444-01 0.1 mL

IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (MaxLight 550)

Sign In for Pricing
View Details
IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (MaxLight 550)
MBS6422444-02 5x 0.1 mL

IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (MaxLight 550)

Sign In for Pricing
View Details