Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-2, His, Human

IGF-BP-2, also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.

Product Specifications

Product Name Alternative

Insulin-like growth factor-binding protein 2, IBP-2, BP-2

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a bioassay using FDC-P1 cells in the presence of 15 ng/ml human IGF-II.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

6-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-2, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-2, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2)
132919 100 µg

S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2)

Sign In for Pricing
View Details
ANKS1B sgRNA CRISPR Lentivector set (Human)
K0094401 3x 1.0 µg

ANKS1B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GRAF (ARHGAP26) (NM_015071) Human Over-expression Lysate
LH09492V 100 µg

GRAF (ARHGAP26) (NM_015071) Human Over-expression Lysate

Sign In for Pricing
View Details
USP28 Polyclonal Antibody, PE-Cy7 Conjugated
bs-5820R-PE-Cy7 100 µL

USP28 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ULTRASONIC CLEANER
BR-2.0L 1 System

ULTRASONIC CLEANER

Sign In for Pricing
View Details
IFluor® A7 Anti-human CD34 Antibody *4H11*
103400S0-AAT 100 Tests

IFluor® A7 Anti-human CD34 Antibody *4H11*

Sign In for Pricing
View Details