Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-2, His, Human

IGF-BP-2, also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.

Product Specifications

Product Name Alternative

Insulin-like growth factor-binding protein 2, IBP-2, BP-2

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a bioassay using FDC-P1 cells in the presence of 15 ng/ml human IGF-II.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

6-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-2, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-2, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500272-01 48 Tests

Mouse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500272-02 96 Tests

Mouse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500272-03 5x 96 Tests

Mouse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500272-04 10x 96 Tests

Mouse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
LINC00474 Protein Vector (Human) (pPM-C-His)
PV054368 500 ng

LINC00474 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Dipk2a shRNA (UAS) - Lentiviral mouse Dipk2a shRNA (UAS, RFP) plasmid
GTR15290941 1 Vial

Lentiviral mouse Dipk2a shRNA (UAS) - Lentiviral mouse Dipk2a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details