What is the catalog number for RecombinantIL-1RA, Human (HEK293-expressed)?

The catalog number for RecombinantIL-1RA, Human (HEK293-expressed) is orb1494643.

What sizes are available for RecombinantIL-1RA, Human (HEK293-expressed)?

RecombinantIL-1RA, Human (HEK293-expressed) is available in the following size(s): 1 mg, 10 µg, 50 µg.

How many pack sizes does RecombinantIL-1RA, Human (HEK293-expressed) come in?

RecombinantIL-1RA, Human (HEK293-expressed) is available in 3 different pack sizes.

Is RecombinantIL-1RA, Human (HEK293-expressed) in stock?

RecombinantIL-1RA, Human (HEK293-expressed) is currently made to order / not held in immediate stock. Contact us for lead time.

RecombinantIL-1RA, Human (HEK293-expressed)

IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

Product Specifications

Product Name Alternative

Interleukin-1 Receptor Antagonist; IL-1RA, ICIL-1RA, IRAP, IL-1RN

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.1 μg /ml, measured in a neutralization assay using D10S cells in the presence of 50pg/ml Human IL-1a.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE