Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1RA, Human (HEK293-expressed)

IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

Product Specifications

Product Name Alternative

Interleukin-1 Receptor Antagonist; IL-1RA, ICIL-1RA, IRAP, IL-1RN

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.1 μg /ml, measured in a neutralization assay using D10S cells in the presence of 50pg/ml Human IL-1a.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STAT5A ELISA Kit
E035274 1 Each

Human STAT5A ELISA Kit

Sign In for Pricing
View Details
ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (MaxLight 750)
MBS6272870-01 0.1 mL

ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (MaxLight 750)

Sign In for Pricing
View Details
ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (MaxLight 750)
MBS6272870-02 5x 0.1 mL

ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (MaxLight 750)

Sign In for Pricing
View Details
Monkey Cd97 ELISA Kit
MBS026685-01 48 Well

Monkey Cd97 ELISA Kit

Sign In for Pricing
View Details
Monkey Cd97 ELISA Kit
MBS026685-02 96 Well

Monkey Cd97 ELISA Kit

Sign In for Pricing
View Details
Monkey Cd97 ELISA Kit
MBS026685-03 5x 96 Well

Monkey Cd97 ELISA Kit

Sign In for Pricing
View Details