Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-2Rα, His, Human

Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ) . The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells) . IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Interleukin-2 Receptor α; IL-2 Rα

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

42 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2B2 3'UTR GFP Stable Cell Line
TU066358 1.0 mL

OR2B2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit
MBS7220334-01 48 Well

Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit

Sign In for Pricing
View Details
Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit
MBS7220334-02 96 Well

Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit

Sign In for Pricing
View Details
Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit
MBS7220334-03 5x 96 Well

Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit

Sign In for Pricing
View Details
Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit
MBS7220334-04 10x 96 Well

Sheep Acetylcholine receptor subunit delta (CHRND) ELISA Kit

Sign In for Pricing
View Details
PATL2 Protein Vector (Mouse) (pPM-C-His)
PV213661 500 ng

PATL2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details