Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-2Rα, His, Human

Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ) . The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells) . IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Interleukin-2 Receptor α; IL-2 Rα

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

42 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CRISP1 shRNA (UAS) - Lentiviral human CRISP1 shRNA (UAS, RFP) (100)
GTR15335991 1 Vial

Lentiviral human CRISP1 shRNA (UAS) - Lentiviral human CRISP1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Electroporation cuvette, 0.4 cm gap width, red cap, individually wrapped, sterile, 50/bag
9104-6050 50 / Bag

Electroporation cuvette, 0.4 cm gap width, red cap, individually wrapped, sterile, 50/bag

Sign In for Pricing
View Details
Total Protein - Human Tumor Tissue: Brain
P1235035 1 mg

Total Protein - Human Tumor Tissue: Brain

Sign In for Pricing
View Details
Six3 Antibody (N-Terminal Region)
R32927 100 µg

Six3 Antibody (N-Terminal Region)

Sign In for Pricing
View Details
Polr1c 3'UTR GFP Stable Cell Line
TU166677 1.0 mL

Polr1c 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)
MBS2061161-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)

Sign In for Pricing
View Details