RecombinantIL-22, Human (HEK293-expressed)
Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family.
Product Specifications
Product Name Alternative
Interleukin-22, IL22
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Active, measured by its ability to activate STAT following receptor ligand interaction.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
16~28 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
KBTBD5 (KLHL40) (NM_152393) Human Recombinant Protein
2,10-Dodecadienedioic-13C12 Acid 1,12-Diethyl Ester
Rfng sgRNA CRISPR Lentivector (Mouse) (Target 3)
