What is the catalog number for RecombinantIL-4R, Human?

The catalog number for RecombinantIL-4R, Human is orb1494637.

What sizes are available for RecombinantIL-4R, Human?

RecombinantIL-4R, Human is available in the following size(s): 1 mg, 10 µg, 50 µg.

How many pack sizes does RecombinantIL-4R, Human come in?

RecombinantIL-4R, Human is available in 3 different pack sizes.

Is RecombinantIL-4R, Human in stock?

RecombinantIL-4R, Human is currently made to order / not held in immediate stock. Contact us for lead time.

RecombinantIL-4R, Human

Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis.

Product Specifications

Product Name Alternative

IL-4R, IL-4RA, CD124

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 70 ng/ml, measured in a neutralization assay using TF-1 cells in the presence of 0.5ng/ml h-IL-4.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

40-45 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL WAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH