Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIP-10/CRG-2/CXCL10, Rat

C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of the skin. Recombinant rat IP-10/CRG-2/CXCL10 produced in HEK 293 cells is a polypeptide chain containing 77 amino acids. A fully biologically active molecule, rr IP-10/CRG-2/CXCL10 has a molecular mass of 8.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Small inducible cytokine B10, CXCL10, 10 kDa interferon-gamma-induced protein, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat IP-10/CRG-2/CXCL10 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells) is less than 300 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8.7 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat IP-10°CRG-2°CXCL10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat IP-10°CRG-2°CXCL10 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEA IKSLLKAVSQRRSKRAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXT2 Human Gene Knockout Kit (CRISPR)
KN204067 1 Kit

EXT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dab1 (C-term) Sheep Polyclonal Antibody
AP05071PU-N 250 µg

Dab1 (C-term) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
TPTE Human Gene Knockout Kit (CRISPR)
KN206018RB 1 Kit

TPTE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spg20 Mouse Gene Knockout Kit (CRISPR)
KN516596 1 Kit

Spg20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF568 conjugate, 0.1mg/mL
BNC682051-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human BCL2L2-PABPN1 activation kit by CRISPRa
GA119362 1 Kit

Human BCL2L2-PABPN1 activation kit by CRISPRa

Sign In for Pricing
View Details