Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNGFR, Human

NGF Receptor, also known as Gp80-LNGFR, p75 ICD, CD271 and TNFRSF16, is a type I transmembrane protein belonging to the TNF receptor family. It is expressed by both neuronal and non-neuronal cells. Signaling through NGF Receptor has been shown to regulate gene expression, cell migration and death. A truncated NGF Receptor containing only the extracellular domain has been detected in plasma, amniotic fluid and urine, and acts as a potent NGF antagonist.

Product Specifications

Product Name Alternative

Gp80-LNGFR, p75 ICD, CD271, TNFRSF16

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 μg /ml, measured in a neutrolization assay using TF-1 cells in the presence of 10ng/ml human b-NGF.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

32-60 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human NGF Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NGF Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCR CAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAEC EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSE1L Protein Lysate 20ug
IHUCSE1LPLLY20UG 20 µg

Human CSE1L Protein Lysate 20ug

Sign In for Pricing
View Details
MMRN2 Rabbit pAb, PerCP-Cy7 conjugated
orb2846860 100 µL

MMRN2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
IER2 (Immediate Early Response Gene 2 Protein, Protein ETR101, ETR101) (MaxLight 750)
MBS6233365-01 0.1 mL

IER2 (Immediate Early Response Gene 2 Protein, Protein ETR101, ETR101) (MaxLight 750)

Sign In for Pricing
View Details
IER2 (Immediate Early Response Gene 2 Protein, Protein ETR101, ETR101) (MaxLight 750)
MBS6233365-02 5x 0.1 mL

IER2 (Immediate Early Response Gene 2 Protein, Protein ETR101, ETR101) (MaxLight 750)

Sign In for Pricing
View Details
Anti-SMARCD1 Antibody (R2M85)
RHK69501 100 μg

Anti-SMARCD1 Antibody (R2M85)

Sign In for Pricing
View Details
Melan-A (ABT193) Antibody
V0393-01 50 µL

Melan-A (ABT193) Antibody

Sign In for Pricing
View Details