Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantOSM, Mouse (HEK293-expressed)

Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.

Product Specifications

Product Name Alternative

Oncostatin M

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

10-40 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD33 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1514R-BF680-01 20 µL

CD33 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CD33 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1514R-BF680-02 100 µL

CD33 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
MVK Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62627R-BF405 100 µL

MVK Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 56 (CCDC56) ELISA kit
GTR10446445 96 Well

Human Coiled coil domain containing protein 56 (CCDC56) ELISA kit

Sign In for Pricing
View Details
Treosulfan
C12345-25mg 25 mg

Treosulfan

Sign In for Pricing
View Details
Goat DNA Polymerase Subunit Gamma-1 (POLG) ELISA Kit
MBS9900979 Inquire

Goat DNA Polymerase Subunit Gamma-1 (POLG) ELISA Kit

Sign In for Pricing
View Details