Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantOSM, Mouse (HEK293-expressed)

Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.

Product Specifications

Product Name Alternative

Oncostatin M

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

10-40 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clotizolam
HY-Q50962 Inquire

Clotizolam

Sign In for Pricing
View Details
Jkamp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4662005 3x 1.0 µg

Jkamp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Dusp15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6323107 1.0 µg DNA

Dusp15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GNB2L1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
22313126 3x 1.0µg DNA

GNB2L1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
1- (chloroacetyl) -6-methoxy-1,2,3,4-tetrahydroquinoline
sc-345083A 1 g

1- (chloroacetyl) -6-methoxy-1,2,3,4-tetrahydroquinoline

Sign In for Pricing
View Details
AARS antibody - C-terminal region
MBS3205178-01 0.1 mL

AARS antibody - C-terminal region

Sign In for Pricing
View Details