Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-CC, Human

Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB) .

Product Specifications

Product Name Alternative

PDGF

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCY_2952 Antibody
orb853146 2 mg

SCY_2952 Antibody

Sign In for Pricing
View Details
FAK Rabbit Polyclonal Antibody (Cy5.5)
orb1052227 100 µL

FAK Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Kif9 (NM_010628) Mouse Tagged Lenti ORF Clone
MR218252L3 10 µg

Kif9 (NM_010628) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TPBG CRISPR All-in-one AAV vector set (with saCas9)(Human)
47345151 3x 1.0 µg DNA

TPBG CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
SERPINB1 Antibody
orb1319504 100 µL

SERPINB1 Antibody

Sign In for Pricing
View Details
TIGD2 Recombinant Protein (Human)
RP101777 100 µg

TIGD2 Recombinant Protein (Human)

Sign In for Pricing
View Details