Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-CC, Human

Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB) .

Product Specifications

Product Name Alternative

PDGF

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human TIMM10 Polyclonal Antibody
PHF48001 100 μg

Anti-Human TIMM10 Polyclonal Antibody

Sign In for Pricing
View Details
SYT11-set siRNA/shRNA/RNAi Lentivector (Human)
45995091 4x 500 ng

SYT11-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rapgef6 3'UTR Lenti-reporter-Luc Vector
38509086 1.0 µg

Rapgef6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ZNF108P sgRNA CRISPR Lentivector (Human) (Target 1)
K2686902 1.0 µg DNA

ZNF108P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Bovine family with sequence similarity 109, member B ELISA Kit
OM624135 96 Strip Well

Bovine family with sequence similarity 109, member B ELISA Kit

Sign In for Pricing
View Details
Daclatasvir (BMS-790052)
A5618-5 5 mg

Daclatasvir (BMS-790052)

Sign In for Pricing
View Details