Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-CC, Human

Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB) .

Product Specifications

Product Name Alternative

PDGF

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RARS2 Rabbit Polyclonal Antibody (Cy3)
orb977411 100 µL

RARS2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Arl5a (NM_182994) Mouse Tagged ORF Clone Lentiviral Particle
MR201586L3V 200 µL

Arl5a (NM_182994) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PEPD Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62736R-PerCP-Cy5.5 100 µL

PEPD Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse MRPL20 shRNA Plasmid
abx975618-01 150 µg

Mouse MRPL20 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MRPL20 shRNA Plasmid
abx975618-02 300 µg

Mouse MRPL20 shRNA Plasmid

Sign In for Pricing
View Details
STX7 Antibody
A35926-100UL 100 µL

STX7 Antibody

Sign In for Pricing
View Details