Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPF-4/CXCL4, Human

Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the α-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.

Product Specifications

Product Name Alternative

PF-4, CXCL4, SCYB4, Platelet Factor-4, CXCL4, Oncostatin A, Ironplact

Source

HEK 293

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 10 ug/ml, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~7.8 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1ORF111 Blocking Peptide
33R-1987 100 ug

C1ORF111 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Clostridium Difficile hpdC Protein (aa 1-85) (strain CD196)
VAng-Lsx9202-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Difficile hpdC Protein (aa 1-85) (strain CD196)

Sign In for Pricing
View Details
Calnexin-CT (CANX) Antibody (ATTO 565)
abx448018 200 µL

Calnexin-CT (CANX) Antibody (ATTO 565)

Sign In for Pricing
View Details
3-Methoxy-1-methyl-2-nitro-1H-pyrrole
426213 100 mg

3-Methoxy-1-methyl-2-nitro-1H-pyrrole

Sign In for Pricing
View Details
Xenopsin-Related Peptide 2
orb1943999-01 5 mg

Xenopsin-Related Peptide 2

Sign In for Pricing
View Details
Xenopsin-Related Peptide 2
orb1943999-02 50 mg

Xenopsin-Related Peptide 2

Sign In for Pricing
View Details