Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTRAILR-2, Human

TRAIL Receptor-2 is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) -induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors TRAIL-R1 or TRAIL-R2 triggers apoptosis in most cancer cells. TRAIL-R2 is associated with a decrease in the survival rates of breast cancer patients.

Product Specifications

Product Name Alternative

Soluble TRAIL Receptor-2, DR5, TNFRSF10B, KILER, TRICK2A, TRICKB

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 6 ng/ml, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/ml of human TRAIL.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTR NTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL1 (Guanine Nucleotide-Binding Protein-like 1, GTP-Binding Protein HSR1, GNL1, HSR1) discontinued
222997-01 50 µL

GNL1 (Guanine Nucleotide-Binding Protein-like 1, GTP-Binding Protein HSR1, GNL1, HSR1) discontinued

Sign In for Pricing
View Details
GNL1 (Guanine Nucleotide-Binding Protein-like 1, GTP-Binding Protein HSR1, GNL1, HSR1) discontinued
222997-02 100 µL

GNL1 (Guanine Nucleotide-Binding Protein-like 1, GTP-Binding Protein HSR1, GNL1, HSR1) discontinued

Sign In for Pricing
View Details
CD161 (NKR, NKR-PI, NKR-P1A, CLEC5B, Killer Cell Lectin like Receptor Subfamily B Member 1, KLRB1) (FITC)
C2548-88F3 100 µg

CD161 (NKR, NKR-PI, NKR-P1A, CLEC5B, Killer Cell Lectin like Receptor Subfamily B Member 1, KLRB1) (FITC)

Sign In for Pricing
View Details
Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 750)
MBS6257174-01 0.1 mL

Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 750)

Sign In for Pricing
View Details
Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 750)
MBS6257174-02 5x 0.1 mL

Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 750)

Sign In for Pricing
View Details
Regulator Of G-Protein Signaling 4 (RGS4) Antibody
abx455456-01 50 µg

Regulator Of G-Protein Signaling 4 (RGS4) Antibody

Sign In for Pricing
View Details