Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTSG, His, Human

Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Twisted Gastrulation Protein

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/ml of TSG.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

30-33 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDT PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHH QNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCMF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADVL sgRNA CRISPR Lentivector set (Human)
K0026401 3x 1.0 µg

ACADVL sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ZNF789 (NM_213603) Human Tagged ORF Clone Lentiviral Particle
RC218578L3V 200 µL

ZNF789 (NM_213603) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Keratocan Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11054R-BF488 100 µL

Keratocan Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal QKI/Quaking Antibody [HRP]
NB300-239H 0.1 mL

Rabbit Polyclonal QKI/Quaking Antibody [HRP]

Sign In for Pricing
View Details
Mouse Heart OptiTDS™3: Tissue Dissociation System
4-28161 1 Kit

Mouse Heart OptiTDS™3: Tissue Dissociation System

Sign In for Pricing
View Details
ZNF451 Human shRNA Plasmid Kit (Locus ID 26036)
TL308168 1 Kit

ZNF451 Human shRNA Plasmid Kit (Locus ID 26036)

Sign In for Pricing
View Details