Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTSG, His, Human

Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Twisted Gastrulation Protein

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/ml of TSG.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

30-33 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDT PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHH QNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCMF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1381-set siRNA/shRNA/RNAi Lentivector (Rat)
33886096 4x 500 ng

Olr1381-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Vmn2r36 shRNA (UAS) - Lentiviral mouse Vmn2r36 shRNA (UAS, iRFP) plasmid
GTR15259864 1 Vial

Lentiviral mouse Vmn2r36 shRNA (UAS) - Lentiviral mouse Vmn2r36 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PRP6 (C-12) P
sc-271882 P 100 µg - 0.5 mL

PRP6 (C-12) P

Sign In for Pricing
View Details
NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 Adapter Protein SPIN90, WASP-interacting SH3-domain Protein, WISH, Wiskott-Aldrich Syndrome Protein-interacting Protein, SPIN90, MGC23891) (Biotin)
130180-Biotin 100 µL

NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 Adapter Protein SPIN90, WASP-interacting SH3-domain Protein, WISH, Wiskott-Aldrich Syndrome Protein-interacting Protein, SPIN90, MGC23891) (Biotin)

Sign In for Pricing
View Details
Iturin A from Bacillus subtilis
B2022545 1 mg

Iturin A from Bacillus subtilis

Sign In for Pricing
View Details
LRRK2 Recombinant Antibody, RBITC Conjugated
bsm-62890R-RBITC-01 20 µL

LRRK2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details